DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and caiA

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_414581.1 Gene:caiA / 949064 ECOCYCID:EG11560 Length:380 Species:Escherichia coli


Alignment Length:420 Identity:82/420 - (19%)
Similarity:120/420 - (28%) Gaps:171/420 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GTMDQQVEWLSKAW-DCEIIG--TYAQTEL--GHGTFLRGLETRADYDASTQEFVINTPSLSAYK 187
            |.:|.....|:..| :...:|  ||...:|  |..||||         ..|||            
E. coli    61 GGLDAGFVTLAAVWMELGRLGAPTYVLYQLPGGFNTFLR---------EGTQE------------ 104

  Fly   188 WWPGGLGHTANHAVVVAQLYTKGEFRGLAPFIVQLRDSDTHRPMPGIDIGDIGTKLGMKGVNNGY 252
                             |:.....|||...   |:.:|....|..|.|:|.:.|           
E. coli   105 -----------------QIDKIMAFRGTGK---QMWNSAITEPGAGSDVGSLKT----------- 138

  Fly   253 LGLKNVRVPLNNMLMKNQQVLPDGTYVAPKNSVLTYGTMMFVRCALIRDTAQSLAKASTIATRYS 317
                                    ||......:...|:..|:              .|:..|.|.
E. coli   139 ------------------------TYTRRNGKIYLNGSKCFI--------------TSSAYTPYI 165

  Fly   318 AVRRQSPIDPNQPEPQIMDHTTQQLKLFPQIAKAIVFKTTGDGIWNMYNVISGEIEQGNLDRLPE 382
            .|..:....|::|         ...:.|..::|..: |.|                  .|::| .
E. coli   166 VVMARDGASPDKP---------VYTEWFVDMSKPGI-KVT------------------KLEKL-G 201

  Fly   383 MHALSCCLKAICSADAAAGVETCRLSCGGHGY------MDCSNF---PTIYGMTTAVCTYEGENT 438
            :...|||  .|...|.... |.......|:|:      .|...|   .|.||  ||:|.:|    
E. coli   202 LRMDSCC--EITFDDVELD-EKDMFGREGNGFNRVKEEFDHERFLVALTNYG--TAMCAFE---- 257

  Fly   439 VMLLQTARYLVK--VYGQALNGEKLVPTVSYISDAINQTKFVNFDGSLRSIVKAFQFVAANKTRI 501
                ..|||..:  .:|:|:...:|:           |.||.:....|.| :|...:.||.|.  
E. coli   258 ----DAARYANQRVQFGEAIGRFQLI-----------QEKFAHMAIKLNS-MKNMLYEAAWKA-- 304

  Fly   502 AYEQIELRRKQGYGTEVAANLCGTFLTAAA 531
                     ..|..|...|.:|..|...||
E. coli   305 ---------DNGTITSGDAAMCKYFCANAA 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 82/420 (20%)
PLN02443 10..669 CDD:178062 82/420 (20%)
caiANP_414581.1 PRK03354 1..380 CDD:179566 82/420 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.