DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and ACX4

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_190752.1 Gene:ACX4 / 824347 AraportID:AT3G51840 Length:436 Species:Arabidopsis thaliana


Alignment Length:479 Identity:101/479 - (21%)
Similarity:166/479 - (34%) Gaps:114/479 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPAKPVNPDLQKERSTATFNP-----REFSVLWAGGEE--RFKEKKALEKLFLEDPALQDDLPI- 57
            :|...::....:....:||.|     ..|:.|....|:  |.|.::.:||         :..|| 
plant    23 LPPMEMSVAFPQATPASTFPPCTSDYYHFNDLLTPEEQAIRKKVRECMEK---------EVAPIM 78

  Fly    58 -SYLSHKELYEHSLRKACIIGEKIRKLRADGEDGVD-TYNALLGGSLGSAILKEGNPLALHYVMF 120
             .|....|...|...|...:|.....::..|..|:. |.||:....:..........:.:|..:.
plant    79 TEYWEKAEFPFHITPKLGAMGVAGGSIKGYGCPGLSITANAIATAEIARVDASCSTFILVHSSLG 143

  Fly   121 VPTIMGQGTMDQQVEWLSKAWDCEIIGTYAQTELGHGTFLRGLETRADYDASTQEFVINTPSLSA 185
            :.||...|:..|:.::|........:..:|.||..:|:...||.|       |...|.....::.
plant   144 MLTIALCGSEAQKEKYLPSLAQLNTVACWALTEPDNGSDASGLGT-------TATKVEGGWKING 201

  Fly   186 YKWWPGGLGHTANHAVVVAQLYTKGEFRGLAPFIVQLRDSDTHRPMPGIDIGDIGTKLGMKGVNN 250
            .|.|.|. ...|:..::.|:..|..:..|   |||:       :..||:....|..|:|::.|.|
plant   202 QKRWIGN-STFADLLIIFARNTTTNQING---FIVK-------KDAPGLKATKIPNKIGLRMVQN 255

  Fly   251 GYLGLKNVRVPLNNMLMKNQQVLPDGTYVAPKNSVLTYGTMMFVRCALIRDTAQSLAKASTIAT- 314
            |.:.|:||.||       ::..||              |...|      :||::.||.:..:.. 
plant   256 GDILLQNVFVP-------DEDRLP--------------GVNSF------QDTSKVLAVSRVMVAW 293

  Fly   315 --------------RYSAVRRQ--SPIDPNQPEPQIMDHTTQQLKLFPQIAKAIVFKTTGDGIWN 363
                          ||...|:|  :|:...|         ..|.||...:.........|..:..
plant   294 QPIGISMGIYDMCHRYLKERKQFGAPLAAFQ---------LNQQKLVQMLGNVQAMFLMGWRLCK 349

  Fly   364 MYNVISGEIEQGNLDRLPEMHALSCCLKAICSADAAAGVETCRLSCGGHGYMDCSNFPTIYGMTT 428
            :|       |.|.:  .|...:|.   ||..|:.|.......|...||:|.:      ..:.:..
plant   350 LY-------ETGQM--TPGQASLG---KAWISSKARETASLGRELLGGNGIL------ADFLVAK 396

  Fly   429 AVC------TYEGENTVMLLQTAR 446
            |.|      ||||...:..|.|.|
plant   397 AFCDLEPIYTYEGTYDINTLVTGR 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 100/472 (21%)
PLN02443 10..669 CDD:178062 100/470 (21%)
ACX4NP_190752.1 PLN02526 27..436 CDD:178141 100/475 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.