DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and AT3G06690

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_187325.4 Gene:AT3G06690 / 819854 AraportID:AT3G06690 Length:187 Species:Arabidopsis thaliana


Alignment Length:141 Identity:33/141 - (23%)
Similarity:55/141 - (39%) Gaps:23/141 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 NLCGTFLTAAADLHGR------AFLAQ--------TAYTELLALSREVSPE-------LAEVLKV 564
            :|...|.:..|.|.||      :||..        .|:||...|...:..|       :.:||.:
plant    48 DLLERFTSEVAQLQGRGESREFSFLLSHQLAEDLGKAFTEKAMLQTILDAEAKLPTGSVKDVLGL 112

  Fly   565 VLELYLVDACLNRIGDFLRFIDLTDQDVTKLEVRLENCLKRFRPNAVSLVDSFDLHDRVLDS-AL 628
            |..:|.: ..|......||:..|:..:|..:...:.......||:|::||.||.:.|..|.. |.
plant   113 VRSMYAL-ISLEEDPSLLRYGYLSQDNVGDVRREVSKLCGELRPHALALVTSFGIPDSFLSPIAF 176

  Fly   629 GAYDGNVYEHI 639
            ...:.|.:..:
plant   177 NWVEANTWSSV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 33/141 (23%)
PLN02443 10..669 CDD:178062 33/141 (23%)
AT3G06690NP_187325.4 ACOX 49..182 CDD:280012 32/133 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.