DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and Acads

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_071957.1 Gene:Acads / 64304 RGDID:620514 Length:414 Species:Rattus norvegicus


Alignment Length:423 Identity:84/423 - (19%)
Similarity:171/423 - (40%) Gaps:77/423 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DPALQDDLPI-SYLSHKELYEHSLRKACIIGEKIRKLRADGEDGVDTYNALLGGSLG----SAIL 107
            |.|.::.:|| :.|..:.|:..|         :::|:...|...:|....|.|..|.    |..|
  Rat    49 DFAEKELVPIAAQLDKEHLFPTS---------QVKKMGELGLLAMDVPEELSGAGLDYLAYSIAL 104

  Fly   108 KE--------GNPLALHYVMFVPTIMGQGTMDQQVEWLSKAWDCEIIGTYAQTELGHGTFLRGLE 164
            :|        |..::::..:::..|:..|:..|:.:|::...:.:.||.:|.:|.|:|:......
  Rat   105 EEISRGCASTGVIMSVNNSLYLGPILKFGSSQQKQQWITPFTNGDKIGCFALSEPGNGSDAGAAS 169

  Fly   165 TRADYDASTQEFVIN-TPSLSAYKWWPGGLGHTANHAVVVAQLYTKGEFRGLAPFIVQLRDSDTH 228
            |.|..:..:  :|:| |.:.....|       .|:..||.|......:.:|::.|:|.:      
  Rat   170 TTAREEGDS--WVLNGTKAWITNSW-------EASATVVFASTDRSRQNKGISAFLVPM------ 219

  Fly   229 RPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVPLNNMLMKNQQVLPDGTYVAPKNSVLTYGTMMF 293
             |.||:.:|....|||::..:...|..::.|:|..|:|.:...    |..:|.:       |:..
  Rat   220 -PTPGLTLGKKEDKLGIRASSTANLIFEDCRIPKENLLGEPGM----GFKIAMQ-------TLDM 272

  Fly   294 VRCALIRDTAQSLAKAS-TIATRYSAVRRQ--SPIDPNQPEPQIMDHTTQQLKLFPQIAKAIVFK 355
            .|.. |...|..:|:|| ..|.:|:..|..  :|:    .:.|.:......:.|..:.|:.:.::
  Rat   273 GRIG-IASQALGIAQASLDCAVKYAENRHAFGAPL----TKLQNIQFKLADMALALESARLLTWR 332

  Fly   356 TTGDGIWNMYNVISGEIEQGNLDRLPEMHALSCCLKAICSADAAAGVETCRLS-CGGHGYMDCSN 419
            ..              :.:.|.....:..|::    .:.:::||..:....:. .||.||:....
  Rat   333 AA--------------MLKDNKKPFTKESAMA----KLAASEAATAISHQAIQILGGMGYVTEMP 379

  Fly   420 FPTIYGMTTAVCTYEGENTVMLLQTARYLVKVY 452
            ....|........|||.:.:..|..|.:|::.|
  Rat   380 AERYYRDARITEIYEGTSEIQRLVIAGHLLRSY 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 84/423 (20%)
PLN02443 10..669 CDD:178062 84/423 (20%)
AcadsNP_071957.1 CaiA 35..414 CDD:224871 84/423 (20%)
SCAD_SBCAD 38..410 CDD:173847 83/419 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.