DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and unk

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_012827260.1 Gene:unk / 613106 XenbaseID:XB-GENE-969153 Length:844 Species:Xenopus tropicalis


Alignment Length:40 Identity:12/40 - (30%)
Similarity:20/40 - (50%) Gaps:5/40 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   609 NAVSLVDSFDLHDRVLDSALGAYDGNVY-----EHIFEST 643
            ||:....:.|..:.|::|||...|.|.:     |..|:|:
 Frog   536 NALPFYPTSDTVESVIESALDDLDLNEFGVAALEKTFDSS 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 12/40 (30%)
PLN02443 10..669 CDD:178062 12/40 (30%)
unkXP_012827260.1 zf_CCCH_5 61..94 CDD:375810
zf-CCCH 319..344 CDD:366217
COG4372 689..>822 CDD:226809
RING_Ubox 804..834 CDD:388418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.