powered by:
Protein Alignment CG5009 and unk
DIOPT Version :9
Sequence 1: | NP_611264.2 |
Gene: | CG5009 / 37028 |
FlyBaseID: | FBgn0027572 |
Length: | 669 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012827260.1 |
Gene: | unk / 613106 |
XenbaseID: | XB-GENE-969153 |
Length: | 844 |
Species: | Xenopus tropicalis |
Alignment Length: | 40 |
Identity: | 12/40 - (30%) |
Similarity: | 20/40 - (50%) |
Gaps: | 5/40 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 609 NAVSLVDSFDLHDRVLDSALGAYDGNVY-----EHIFEST 643
||:....:.|..:.|::|||...|.|.: |..|:|:
Frog 536 NALPFYPTSDTVESVIESALDDLDLNEFGVAALEKTFDSS 575
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1960 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.