DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and gcdhb

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001006024.1 Gene:gcdhb / 450003 ZFINID:ZDB-GENE-041010-117 Length:427 Species:Danio rerio


Alignment Length:455 Identity:105/455 - (23%)
Similarity:172/455 - (37%) Gaps:127/455 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KKALEKLFLEDPALQ----DDLPISYLSHKE--LYEHSLRKACIIGEKI--RKLRAD-------- 86
            :|:.|:..::.|.:|    |.|.:..|..:|  :...|.|..|  .||:  |.|.|:        
Zfish    35 EKSGERKQMKAPKVQFNWRDALDLEGLLTEEEIMIRDSFRTYC--QEKLMPRILMANRNEIFHRE 97

  Fly    87 -----GEDGVDTYNALLG------GSLGSAILKEG--------------NPLALHYVMFVPTIMG 126
                 ||.||      ||      |..|::.:..|              :.:::...:.:..|..
Zfish    98 IVSEMGELGV------LGPTIKGYGCAGTSYVAYGLIAREVERVDSGYRSVMSVQSSLVMHPINA 156

  Fly   127 QGTMDQQVEWLSKAWDCEIIGTYAQTELGHGTFLRGLETRADYDASTQEFVINTPSLSAYKWW-- 189
            .||.:|:.::|.:....||:|.:..||..||:....:||:|.|::|:..|     :|:..|.|  
Zfish   157 YGTEEQKQKYLPRLAQGEILGCFGLTEPNHGSDPGSMETKAKYNSSSHTF-----TLTGSKTWIT 216

  Fly   190 --PGGLGHTANHAVVVAQLYTKGEFRGLAPFIVQLRDSDTHRPMPGIDIGDIGTKLGMKGVNNGY 252
              |     .|:..||.|:. ..|:.||   ||::       |.|.|:....|..|..::....|.
Zfish   217 NSP-----VADICVVWAKC-EDGKVRG---FILE-------RGMKGLSTPKIEGKFSLRASATGM 265

  Fly   253 LGLKNVRVPLNNMLMKNQQVLPDGTYVAPKNSVLT--YGTMMFVRCALIRDTAQSLAKASTIATR 315
            :.:..|.||..|:|              ||.|.|.  :|.:...|..:......:.......|.:
Zfish   266 IIMDEVEVPEENLL--------------PKASGLAGPFGCLNNARYGIAWGALGAAEFCFHAARQ 316

  Fly   316 YSAVRRQ--SPIDPNQPEPQIMDHTTQQLKLFPQIAKAIVFKTTGDGIWNMYNVISGEIEQGNL- 377
            |:..|.|  .|:..||                      ::.|...|.:..:...:...::.|.| 
Zfish   317 YTLDRIQFGVPLARNQ----------------------LMQKKMADMLTEITLGLQSCLQLGRLI 359

  Fly   378 -DR--LPEMHAL---SCCLKAICSADAAAGVETCRLSCGGHGYMDCSNFPTIYGMTTAVCTYEGE 436
             |:  .|||.:|   :.|.||:..|..|      |...||:|..|..:.........||.||||:
Zfish   360 DDKKAAPEMISLLKRNSCGKALDIARQA------RDMLGGNGIADEYHIIRHVLNLEAVNTYEGQ 418

  Fly   437  436
            Zfish   419  418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 105/455 (23%)
PLN02443 10..669 CDD:178062 105/455 (23%)
gcdhbNP_001006024.1 GCD 50..418 CDD:173840 100/438 (23%)
CaiA 62..426 CDD:224871 98/428 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.