DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and acads

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001003743.1 Gene:acads / 445288 ZFINID:ZDB-GENE-040808-64 Length:405 Species:Danio rerio


Alignment Length:444 Identity:96/444 - (21%)
Similarity:171/444 - (38%) Gaps:115/444 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DPALQDDLPISYLSHKELYEHSLRKACIIGEKIRKLRADGEDGVDTYNALLGGS----------- 101
            |.|.::..||:.|..|   ||...     .:::::|.|.|...|:...: |||:           
Zfish    40 DYAQKELAPIAGLLDK---EHRFP-----AKQVQELGAMGVMAVEVPES-LGGAGMDYLAYCLAV 95

  Fly   102 --LGSAILKEGNPLALHYVMFVPTIMGQGTMDQQVEWLSKAWDCEIIGTYAQTELGHGTFLRGLE 164
              |.......|..::::..:::..|:..|:.:|:.:|::.....|.:|.:|.:|.|:|:......
Zfish    96 EELSRGCASTGVIVSVNNSLYIGPILKFGSEEQKKQWITPFTTGEKVGCFALSEPGNGSDAGAAS 160

  Fly   165 TRADYDASTQEFVIN-TPSLSAYKWWPGGLGHTANHAVVVAQLYTKGEFRGLAPFIVQLRDSDTH 228
            |.|..:.:  |:|:| |.:.....|       .|:..||.|......:.:|::.|:|.:      
Zfish   161 TLAQQEGN--EWVLNGTKAWITNSW-------DASATVVFATTDKSLKHKGISAFLVPM------ 210

  Fly   229 RPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVPLNNMLMKN-------QQVLPDGTYVAPKNSVL 286
             |.||:.:|....|||::..:...:.|::.|:||.|||.:.       .|.|..|          
Zfish   211 -PHPGLSLGKKEDKLGIRASSTANIILEDCRIPLGNMLGERGMGFKIAMQTLDSG---------- 264

  Fly   287 TYGTMMFVRCALIRDTAQSLAKASTIATRYSAVRRQSPIDPNQPEPQIMDHTTQQLKLFPQIAK- 350
                    |..:   .||:|..|            |:.:|      ...|:..::......|.| 
Zfish   265 --------RLGI---AAQALGIA------------QAALD------CAADYAHKRTAFGAPIGKL 300

  Fly   351 -AIVFKTTGDGIWNMYNVISGEIEQGNLDRLPEMHAL----------SCCLKAICSADAA--AGV 402
             ||.||.....:         .||...|  |....||          ...:..:.:::||  |..
Zfish   301 QAIQFKLADMAV---------AIESARL--LTWKAALLRDAKKPFTKEAAMAKLAASEAATFASH 354

  Fly   403 ETCRLSCGGHGYMDCSNFPTIYGMTTAVCT--YEGENTVMLLQTARYLVKVYGQ 454
            :..:: .||.||:  ::.|.......|..|  |||.:.:..|..|..::|.|.|
Zfish   355 QAIQV-LGGMGYV--TDMPAERHYRDARITEIYEGTSEIQRLVIANNILKEYQQ 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 96/444 (22%)
PLN02443 10..669 CDD:178062 96/444 (22%)
acadsNP_001003743.1 CaiA 26..405 CDD:224871 95/442 (21%)
SCAD_SBCAD 29..401 CDD:173847 93/438 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.