DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and CG4860

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_650163.2 Gene:CG4860 / 41480 FlyBaseID:FBgn0037999 Length:415 Species:Drosophila melanogaster


Alignment Length:407 Identity:85/407 - (20%)
Similarity:159/407 - (39%) Gaps:74/407 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HSLRKACIIGEKIRKLRADGEDGV--DTYNALLGGS--------LGSAILKEGNPLALHYVM--- 119
            |..|:.....|::|:|   ||.|:  .|.....|||        :|...:..|: .|:..||   
  Fly    62 HHDREELYPAEQVRRL---GELGLMSVTVREEYGGSGLDYQAYAIGMEEVARGD-AAVSIVMGVN 122

  Fly   120 --FVPTIMGQGTMDQQVEWLSKAWDCEIIGTYAQTELGHGTFLRGLETRADYDASTQEFVINTPS 182
              ::..:...||..|:.::|......|.|..||.:|.|:|:......|.|.....:.:       
  Fly   123 NLYLGAVQQHGTEQQKQDFLVPYTQGEHIAFYALSEPGNGSDAGAASTTAKLQGDSYQ------- 180

  Fly   183 LSAYKWWPGGLGHTANHAVVVAQLYTKGEFRGLAPFIVQLRDSDTHRPMPGIDIGDIGTKLGMKG 247
            ::..|.|... ...|:..:|.|.:....:.:|:..|:       |.:.:||:.|....:|:||:.
  Fly   181 INGTKAWISN-SKEASGGIVFATVDKSMKHKGITAFL-------TPKDVPGLSIAKKESKMGMRA 237

  Fly   248 VNNGYLGLKNVRVPLNNMLMKNQQVLPDGTYVAPKNSVLTYGTMMFVRCALIRDTAQS--LAKAS 310
            .:...|.|::|.||.:.:|    ....||..:|          |..:.|..|...||:  :|:|:
  Fly   238 TSTCQLVLEDVHVPRSRVL----GAAGDGFKIA----------MQSLDCGRIGIAAQATGIAQAA 288

  Fly   311 -TIATRYSAVRRQSPIDPNQPEPQIMDHTTQQLKLFPQIAKAIVFKTTGDGIWNMYNVISGEIEQ 374
             .:|..||  :::.....:....|::......:....:|::.:.::..    |...|.:....|.
  Fly   289 LELAVDYS--QKRVAFGKHLARLQLIQQKLADMATRVEISRLLTWRAA----WLKDNGLPITKEA 347

  Fly   375 GNLDRLPEMHALSCCLKAICSADAAAGVETCRLSCGGHGYMDCSNFPT-IYGMTTAVC-TYEGEN 437
            .    :.::||         |..|......|....||.||  .::.|. :|.....|. .|||.:
  Fly   348 A----MAKLHA---------SESATFCAHQCIQILGGMGY--TTDLPAELYYRNARVTEIYEGTS 397

  Fly   438 TVMLLQTARYLVKVYGQ 454
            .:..:..|..:::..|:
  Fly   398 EIQRIVIANAVLRELGK 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 85/407 (21%)
PLN02443 10..669 CDD:178062 85/407 (21%)
CG4860NP_650163.2 CaiA 37..414 CDD:224871 84/405 (21%)
SCAD_SBCAD 39..410 CDD:173847 84/401 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460776
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.