DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and CG6638

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_648239.1 Gene:CG6638 / 38979 FlyBaseID:FBgn0035911 Length:420 Species:Drosophila melanogaster


Alignment Length:485 Identity:112/485 - (23%)
Similarity:177/485 - (36%) Gaps:127/485 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PVN-------PDLQKERSTATFN---------PREFSVLWAGGEERFKEKKAL-EKL----FLED 48
            |||       .|.||.|..| ||         .:|...|     :.||:.:.. :||    ||..
  Fly    31 PVNDAMFGLDEDRQKLREVA-FNFFQKELAPLAKEIDKL-----DNFKDMRPFWKKLGALGFLGI 89

  Fly    49 PALQD--DLPISYLSHKELYEHSLRKACIIGEKIRKLRADGEDGVDTYNALLGGSLGSAILKEGN 111
            .|..|  ....|||.|           |||.|:..:                  :.|...|..| 
  Fly    90 TAEPDFGGTGGSYLDH-----------CIIMEEFSR------------------AAGGVALSYG- 124

  Fly   112 PLALHYVMFVPTIMGQGTMDQQVEWLSKAWDCEIIGTYAQTELGHGTFLRGLETRA----DYDAS 172
               .|..:.:..:...||.:|:.::|.|....|.:|..|.:|.|.|:.:..::.||    ||   
  Fly   125 ---AHSNLCINQLTKNGTPEQKEKYLPKLCSGEHVGGLAMSEPGAGSDVVSMKLRAERKGDY--- 183

  Fly   173 TQEFVINTPSLSAYKWWPGGLGHTANHAVVVAQLYTKG--EFRGLAPFIVQLRDSDTHRPMPGID 235
               :|:|     ..|:|... |..|:..:|.|:....|  :..|:..|||:       ....|..
  Fly   184 ---YVLN-----GSKFWITN-GSDADTLIVYAKTGGSGVPDKHGITAFIVE-------TAWEGFS 232

  Fly   236 IGDIGTKLGMKGVNNGYLGLKNVRVPLNNMLMKNQQVLPDGTYVAPKNSVLTYGTMMFVRCALIR 300
            :.....||||:|.:...|..::::||..|:|.:..:    |.|      ||..| :.|.|..|..
  Fly   233 VAQKLDKLGMRGSSTCELVFQDLKVPAKNILGQENR----GVY------VLMSG-LDFERLVLAA 286

  Fly   301 DTAQSLAKASTIATRYSAVRRQSPIDPNQPEPQIMDHTTQQLKLFPQIAKAIVFKTTGDGIWNMY 365
            .....:..|..:|..|:..|:|            |:....:.:|..  .|.....||.....:..
  Fly   287 GPVGLMQAACDVAFDYAHQRKQ------------MNKLIGEFQLLQ--GKMADMYTTLSACRSYL 337

  Fly   366 NVISGEIEQGNLDRLPEMHALSCCLKAICSADAAAGVETCRLS-CGGHGYMDCSNFPTIYGMTTA 429
            ..::...:.||  |.|:    .|....:.:|:.|..|....:. .||:||:  :..||...:..|
  Fly   338 YTVARSCDAGN--RSPK----DCAGVILYTAEKATKVALDAIQILGGNGYI--NENPTGRILRDA 394

  Fly   430 VCTYEGENTVMLLQTARYLVKVYGQALNGE 459
            .....|..|   .:..|:|:   |:.||.|
  Fly   395 KLYEIGAGT---SEIRRWLI---GRQLNQE 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 109/475 (23%)
PLN02443 10..669 CDD:178062 108/473 (23%)
CG6638NP_648239.1 PLN02519 14..418 CDD:215284 111/483 (23%)
IVD 38..417 CDD:173845 107/475 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460752
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.