DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and IVD

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_016877638.1 Gene:IVD / 3712 HGNCID:6186 Length:516 Species:Homo sapiens


Alignment Length:461 Identity:97/461 - (21%)
Similarity:165/461 - (35%) Gaps:128/461 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ERFKEKKALEKLFLEDPALQDDLPISYLSHKELYEHSLRKACIIGEKIRKLRADGEDGVDTYNAL 97
            |.:|:...|..|.:..|.......:.||.|           .::.|:|.  ||.|..|: :|.| 
Human   111 EFWKQLGNLGVLGITAPVQYGGSGLGYLEH-----------VLVMEEIS--RASGAVGL-SYGA- 160

  Fly    98 LGGSLGSAILKEGNPLALHYVMFVPTIMGQGTMDQQVEWLSKAWDCEIIGTYAQTELGHGTFLRG 162
                              |..:.:..::..|...|:.::|.|....|.||..|.:|...|:.:..
Human   161 ------------------HSNLCINQLVRNGNEAQKEKYLPKLISGEYIGALAMSEPNAGSDVVS 207

  Fly   163 LETRADYDASTQEFVINTPSLSAYKWWPGGLGHTANHAVVVAQ--LYTKGEFRGLAPFIVQLRDS 225
            ::.:|:...:  .:::|     ..|:|... |..|:..:|.|:  |......||:..|||:    
Human   208 MKLKAEKKGN--HYILN-----GNKFWITN-GPDADVLIVYAKTDLAAVPASRGITAFIVE---- 260

  Fly   226 DTHRPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVPLNNML---MKNQQVLPDGTYVAPKNSVLT 287
               :.|||........||||:|.|...|..::.::|..|:|   .|...||..|..:  :..||.
Human   261 ---KGMPGFSTSKKLDKLGMRGSNTCELIFEDCKIPAANILGHENKGVYVLMSGLDL--ERLVLA 320

  Fly   288 YGTMMFVRCAL--------IRDT-AQSL-------AKASTIATRYSAVRRQSPIDPNQPEPQIMD 336
            .|.:..::..|        :|:. .|.:       .|.:.:.||..|.|:.              
Human   321 GGPLGLMQAVLDHTIPYLHVREAFGQKIGHFQLMQGKMADMYTRLMACRQY-------------- 371

  Fly   337 HTTQQLKLFPQIAKAIVFKTTGDGIWNMYNVISGEIEQGNLDRLPEMHALSCCLKAICSADAAAG 401
                                       :|||... .::|:..      |..|....:.||:.|..
Human   372 ---------------------------VYNVAKA-CDEGHCT------AKDCAGVILYSAECATQ 402

  Fly   402 VETCRLSCGGHGYMDCSNFPTIYGMTTAVCTYEGENTVMLLQTARYL-VKVYGQALNGEKLVPTV 465
            |....:.|.|..: ...:.|...|.|      .|:.::..:.|||.| .|:....|....|:|.:
Human   403 VALDGIQCFGQTF-SAQHPPGREGET------RGQTSLEQVSTARELRCKILLPELTPRVLLPQL 460

  Fly   466 -SYISD 470
             |:|||
Human   461 ASWISD 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 97/461 (21%)
PLN02443 10..669 CDD:178062 97/461 (21%)
IVDXP_016877638.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.