DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and Egm

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_610687.1 Gene:Egm / 36242 FlyBaseID:FBgn0086712 Length:639 Species:Drosophila melanogaster


Alignment Length:370 Identity:84/370 - (22%)
Similarity:130/370 - (35%) Gaps:97/370 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AKPVNPDLQKERSTATFNP--REFSVLWAGGEERFKEKKALEKLFLEDPALQDD---LPIS--YL 60
            |:.|....:::|...|..|  :.|.:   |..:  ||..|..::...|...|.:   ||:.  ::
  Fly    50 AESVEESPEQQRKLPTREPLAKNFFI---GVVD--KELLAYPEVIPRDEMAQLENSLLPLKNYFV 109

  Fly    61 SHKELYEHS---LRKACIIGEKI------------RKLRADGEDGVDTYNALLGGSLGSAILKEG 110
            ..:|..|.|   ||:..:.|..:            ..|.|...|..| .|..||           
  Fly   110 EPRETEETSPETLRQLGLYGLNVSTDYEGKGYGWSASLMASEPDSTD-INVTLG----------- 162

  Fly   111 NPLALHYVMFVPTIMGQGTMDQQVEWLSKAWDCEIIGTYAQTELGHGTFLRGLETRADYDASTQE 175
              |..|.|: |..:...||..||..:|......::|||.|..|:.        ....||..:|.|
  Fly   163 --LQTHRVV-VDLLKEVGTPLQQQRYLQDLATGKLIGTEAIYEIS--------PPEEDYFNTTAE 216

  Fly   176 FVINTPSLSAYKWWPGGLGHTANHAVVVAQLYTKGEFRGLAPFIVQLRDSDTHRP-MPG------ 233
            ..   |...  ||...|     ..:.|:.   |.|| |.|  |:|.   :.|.:| :||      
  Fly   217 LF---PEYG--KWQLNG-----EKSFVIC---TPGE-RQL--FLVL---AQTQQPNVPGVLGRGT 262

  Fly   234 ----IDIGDIGTKLGMKGVNNGYLGLKNVRVPLNNMLMKNQQV--LP-DGTYVAPKNSVLTYGTM 291
                :|....|.:||.|....|....:..||....:.:...||  || ||...:.:         
  Fly   263 TIFLVDSQQEGVRLGEKHATFGCRKAEIRRVHFEGVKLGEDQVVGLPHDGNRYSEQ--------- 318

  Fly   292 MFVRCALIRDTAQSLAKASTIATRYSAVRRQSPIDPNQPEPQIMD 336
             .||.:.:|.:...|:.|..:....:    |..::..|...|:.|
  Fly   319 -LVRSSRLRGSLVGLSLAKKLLNELA----QYTVNTTQCGVQLQD 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 82/365 (22%)
PLN02443 10..669 CDD:178062 82/363 (23%)
EgmNP_610687.1 ACAD 92..457 CDD:173838 74/323 (23%)
CaiA 122..439 CDD:224871 67/293 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.