DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and ACADSB

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001600.1 Gene:ACADSB / 36 HGNCID:91 Length:432 Species:Homo sapiens


Alignment Length:269 Identity:65/269 - (24%)
Similarity:111/269 - (41%) Gaps:64/269 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLQKERSTATFNPREFSVLWAGGEERFK-EKKALEKLFLE-------DPALQDDLPISYLSHKEL 65
            ::..:.|...|...:.:.|.:..:|..| ||..::.||.:       ||. ......|:||    
Human    61 EMMIKSSVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGLMGIEVDPE-YGGTGASFLS---- 120

  Fly    66 YEHSLRKACIIGEKIRKLRADGEDGVDTYNALLGGSLGSAILKEGNPLALHYVMFVPTIMGQGTM 130
                   ..::.|::.|:.|......:..|.|:            |.|          |...||.
Human   121 -------TVLVIEELAKVDASVAVFCEIQNTLI------------NTL----------IRKHGTE 156

  Fly   131 DQQVEWLSKAWDCEIIGTYAQTELGHGTFLRGLETRADYDASTQEFVINTPSLSAYKWWPGGLGH 195
            :|:..:|.:. ..|.:|::..:|.|.|:....|:||||.:.  ..:|:|     ..|.|..    
Human   157 EQKATYLPQL-TTEKVGSFCLSEAGAGSDSFALKTRADKEG--DYYVLN-----GSKMWIS---- 209

  Fly   196 TANHA---VVVAQLYTKGEFRGLAPFIVQLRDSDTHRPMPGIDIGDIGTKLGMKGVNNGYLGLKN 257
            :|.||   :|:|.:.....::|:..|:|   |.||    ||:.||....|||::..:...|..:|
Human   210 SAEHAGLFLVMANVDPTIGYKGITSFLV---DRDT----PGLHIGKPENKLGLRASSTCPLTFEN 267

  Fly   258 VRVPLNNML 266
            |:||..|:|
Human   268 VKVPEANIL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 65/269 (24%)
PLN02443 10..669 CDD:178062 65/268 (24%)
ACADSBNP_001600.1 CaiA 57..428 CDD:224871 65/269 (24%)
SCAD_SBCAD 59..430 CDD:173847 65/269 (24%)
Substrate binding. /evidence=ECO:0000269|Ref.15 291..294
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.