DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and ACADS

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_000008.1 Gene:ACADS / 35 HGNCID:90 Length:412 Species:Homo sapiens


Alignment Length:434 Identity:88/434 - (20%)
Similarity:170/434 - (39%) Gaps:114/434 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SHKELY--------EHSLRKACIIGEKIRKLRADGEDGVDTYNALLGGS----LGSAILKE---- 109
            :.|||:        ||....|     :::|:...|...:|.... |||:    |..||..|    
Human    49 AEKELFPIAAQVDKEHLFPAA-----QVKKMGGLGLLAMDVPEE-LGGAGLDYLAYAIAMEEISR 107

  Fly   110 -----GNPLALHYVMFVPTIMGQGTMDQQVEWLSKAWDCEIIGTYAQTELGHGTFLRGLET--RA 167
                 |..::::..:::..|:..|:.:|:..|::.....:.||.:|.:|.|:|:......|  ||
Human   108 GCASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGSDAGAASTTARA 172

  Fly   168 DYDA----STQEFVINTPSLSAYKWWPGGLGHTANHAVVVAQLYTKGEFRGLAPFIVQLRDSDTH 228
            :.|:    .|:.::.|.        |      .|:.|||.|......:.:|::.|:|.:      
Human   173 EGDSWVLNGTKAWITNA--------W------EASAAVVFASTDRALQNKGISAFLVPM------ 217

  Fly   229 RPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVPLNNMLMKNQQVLPDGTYVAPKNSVLTYGTMMF 293
             |.||:.:|....|||::|.:...|..::.|:                    ||:|:|....|.|
Human   218 -PTPGLTLGKKEDKLGIRGSSTANLIFEDCRI--------------------PKDSILGEPGMGF 261

  Fly   294 VRCAL-------IRDTAQSLAKAST---IATRYSAVRRQ--SPIDPNQPEPQIMDHTTQQLKLFP 346
             :.|:       |...:|:|..|.|   .|..|:..|..  :|:    .:.|::......:.|..
Human   262 -KIAMQTLDMGRIGIASQALGIAQTALDCAVNYAENRMAFGAPL----TKLQVIQFKLADMALAL 321

  Fly   347 QIAKAIVFKTTGDGIWNMYNVISGEIEQGNLDRLPEMHALSCCLKAICSADAAAGVETCRLS-CG 410
            :.|:.:.::             :..::......:.|     ..:..:.:::||..:....:. .|
Human   322 ESARLLTWR-------------AAMLKDNKKPFIKE-----AAMAKLAASEAATAISHQAIQILG 368

  Fly   411 GHGYMDCSNFPTIYGMTTAVCT--YEGENTVMLLQTARYLVKVY 452
            |.||:  :..|.......|..|  |||.:.:..|..|.:|::.|
Human   369 GMGYV--TEMPAERHYRDARITEIYEGTSEIQRLVIAGHLLRSY 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 88/434 (20%)
PLN02443 10..669 CDD:178062 88/434 (20%)
ACADSNP_000008.1 CaiA 33..412 CDD:224871 88/434 (20%)
SCAD_SBCAD 36..408 CDD:173847 87/430 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.