DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and ACADM

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001272972.1 Gene:ACADM / 34 HGNCID:89 Length:454 Species:Homo sapiens


Alignment Length:395 Identity:87/395 - (22%)
Similarity:151/395 - (38%) Gaps:95/395 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ACIIGEKIRKLRADGEDGVDTYNALLGGSLGSAILKEGNPLALHYVMFVPTIMGQGTMDQQVEWL 137
            ||:|.|::    |.|..||.|  |:.|.|||.                :|.|:. |...|:.::|
Human   138 ACLISEEL----AYGCTGVQT--AIEGNSLGQ----------------MPIIIA-GNDQQKKKYL 179

  Fly   138 SKAWDCEIIGTYAQTELGHGTFLRGLETRADYDASTQEFVINTPSLSAYKWWPGGLGHTANHAVV 202
            .:..:..::..|..||.|.|:.:.|::|:|  :....|::||     ..|.|... |..||...:
Human   180 GRMTEEPLMCAYCVTEPGAGSDVAGIKTKA--EKKGDEYIIN-----GQKMWITN-GGKANWYFL 236

  Fly   203 VA------QLYTKGEFRGLAPFIVQLRDSDTHRPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVP 261
            :|      :......|.|   |||   ::||    |||.||.....:|.:..:...:..::|:||
Human   237 LARSDPDPKAPANKAFTG---FIV---EADT----PGIQIGRKELNMGQRCSDTRGIVFEDVKVP 291

  Fly   262 LNNMLMKNQQVLPDGTYVAPKNSVLTYGTMMFVRCALIRDTAQSLAKASTIATRYSAVRRQSPID 326
            ..|:|      :.||.     ...:..|.....|..:.........:|...||:|:..|:  ...
Human   292 KENVL------IGDGA-----GFKVAMGAFDKTRPVVAAGAVGLAQRALDEATKYALERK--TFG 343

  Fly   327 PNQPEPQIMDHTTQQLKLFPQIAKAIVFKTTGDGIWNMYNVISGEIEQGNLDRLPEMHALSCCLK 391
            ....|.|.:.....::.:..::|:.            .|...:.|::.|..:..     .:...|
Human   344 KLLVEHQAISFMLAEMAMKVELARM------------SYQRAAWEVDSGRRNTY-----YASIAK 391

  Fly   392 AICSADAAAGVETCRLS-CGGHGYMDCSNFPT--------IYGMTTAVCTYEGENTVMLLQTARY 447
            |. :.|.|..:.|..:. .||:|:.  :.:|.        ||.:      |||.:.:..|..||.
Human   392 AF-AGDIANQLATDAVQILGGNGFN--TEYPVEKLMRDAKIYQI------YEGTSQIQRLIVARE 447

  Fly   448 LVKVY 452
            .:..|
Human   448 HIDKY 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 87/395 (22%)
PLN02443 10..669 CDD:178062 87/395 (22%)
ACADMNP_001272972.1 CaiA 39..453 CDD:224871 87/395 (22%)
MCAD 41..451 CDD:173846 86/392 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.