DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and ACAD8

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_024304205.1 Gene:ACAD8 / 27034 HGNCID:87 Length:493 Species:Homo sapiens


Alignment Length:306 Identity:68/306 - (22%)
Similarity:119/306 - (38%) Gaps:47/306 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KEKKALEKLFLEDPALQDDLPISYLSHKELYE-HSLRKACIIGEKIRKLRAD----GEDGVDT-- 93
            :|:|..:|:..:..|.:....::....|||:. ..:|||..:|.....::.|    |...:||  
Human    43 EEQKEFQKVAFDFAAREMAPNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSV 107

  Fly    94 -YNALLGGSLGSAILKEGNPLALHYVMFVPTIMGQGTMDQQVEWLSKAWDCEIIGTYAQTELGHG 157
             :.||..|...:...     :::|. |....|...|..:|:.::.......|...:|..||.|.|
Human   108 IFEALATGCTSTTAY-----ISIHN-MCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSG 166

  Fly   158 TFLRGLETRADYDASTQEFVINTPSLSAYKWWPGGLGHTANHAVVVAQLYTKGEF-RGLAPFIVQ 221
            :....|.|.|....  ..:::|     ..|.:..|.|.:   .:.|....|.|.. :|::..:|:
Human   167 SDAASLLTSAKKQG--DHYILN-----GSKAFISGAGES---DIYVVMCRTGGPGPKGISCIVVE 221

  Fly   222 LRDSDTHRPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVPLNNMLMKNQQVLPDGTYVAPKNSVL 286
                   :..||:..|....|:|........:..::..||:.|.:....|    |..:|.:.  |
Human   222 -------KGTPGLSFGKKEKKVGWNSQPTRAVIFEDCAVPVANRIGSEGQ----GFLIAVRG--L 273

  Fly   287 TYGTMMFVRCALIRDTAQSLAKASTIATR-YSAVRRQ--SPIDPNQ 329
            ..|.:....|:|      ..|.||.|.|| :..||:|  .|:..||
Human   274 NGGRINIASCSL------GAAHASVILTRDHLNVRKQFGEPLASNQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 68/306 (22%)
PLN02443 10..669 CDD:178062 68/306 (22%)
ACAD8XP_024304205.1 IBD 41..387 CDD:173851 68/306 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.