DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and Acadsb

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_008758088.1 Gene:Acadsb / 25618 RGDID:2013 Length:449 Species:Rattus norvegicus


Alignment Length:267 Identity:66/267 - (24%)
Similarity:107/267 - (40%) Gaps:56/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DLQKERSTATFNPREFSVLWAGGEERFK-EKKALEKLF------LEDPALQDDLPISYLSHKELY 66
            |:..:::...|...:.:.|.:..:|..| ||..::.||      :|..|.......|:|.     
  Rat    61 DIMMQKAVKKFAQEQIAPLVSTMDENSKMEKSVIQGLFQQGMMGIEVEAKYGGTEASFLC----- 120

  Fly    67 EHSLRKACIIGEKIRKLRADGEDGVDTYNALLGGSLGSAILKEGNPLALHYVMFVPTIMGQGTMD 131
                  :.::.|::.|        ||...|||.....:.|.|              .....||.:
  Rat   121 ------SVLVIEELAK--------VDASVALLCDIQNTVINK--------------LFRKHGTEE 157

  Fly   132 QQVEWLSKAWDCEIIGTYAQTELGHGTFLRGLETRADYDASTQEFVINTPSLSAYKWWPGGLGHT 196
            |:..:|.|. ..|.:|::..:|.|.|:....|:|||  |.|...:|||     ..|.|.....| 
  Rat   158 QKATYLPKL-VTEKLGSFCLSEAGAGSDSFALKTRA--DKSGNYYVIN-----GSKMWISNAEH- 213

  Fly   197 ANHAVVVAQLYTKGEFRGLAPFIVQLRDSDTHRPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVP 261
            |...:|.|.:.....:||:..|:|   |.||.    |..||....|:|::..:...|..:||:||
  Rat   214 AELFLVFANVDPPSGYRGITCFLV---DRDTE----GFQIGRRENKMGIRASSTCQLTFENVKVP 271

  Fly   262 LNNMLMK 268
            ..::|.|
  Rat   272 ETSVLGK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 66/267 (25%)
PLN02443 10..669 CDD:178062 65/266 (24%)
AcadsbXP_008758088.1 CaiA 57..409 CDD:224871 66/267 (25%)
SCAD_SBCAD 59..409 CDD:173847 66/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.