DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and acdh-6

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_498885.1 Gene:acdh-6 / 182112 WormBaseID:WBGene00015335 Length:408 Species:Caenorhabditis elegans


Alignment Length:163 Identity:36/163 - (22%)
Similarity:68/163 - (41%) Gaps:23/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 GSLGSAILKEGNPLALHYVMFVPTIMGQGTMDQQVEWLSKAWDCEIIGTYAQTELGHGTFLRGLE 164
            ||:..:::.:.:       |..|.:...|:...:..:|..:.:.:::.:.|.:|...|:.:..:.
 Worm   103 GSIPMSVMVQSD-------MSTPALAQFGSDSLRNRFLRPSINGDLVSSIAVSEPHAGSDVSAIR 160

  Fly   165 TRADYDASTQEFVINTPSLSAYKWWPGGLGHTANHA-VVVAQLYTKGEFRGLAPFIVQLRDSDTH 228
            |.|....|  :.:||     ..|.|... |..|:.| |:|.....|...:..:...:.|.....|
 Worm   161 THARRYGS--DLIIN-----GSKMWITN-GDQADWACVLVNTSNAKNLHKNKSLVCIPLDSIGVH 217

  Fly   229 RPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVP 261
            |..| :|      ||||:..:...|..::||||
 Worm   218 RSTP-LD------KLGMRSSDTVQLFFEDVRVP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 36/163 (22%)
PLN02443 10..669 CDD:178062 36/163 (22%)
acdh-6NP_498885.1 CaiA 23..396 CDD:224871 36/163 (22%)
Acyl-CoA_dh_N 29..140 CDD:280866 6/43 (14%)
ACAD 115..396 CDD:173838 34/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.