DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and acdh-2

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001343623.1 Gene:acdh-2 / 173940 WormBaseID:WBGene00015894 Length:386 Species:Caenorhabditis elegans


Alignment Length:343 Identity:77/343 - (22%)
Similarity:142/343 - (41%) Gaps:86/343 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EKKALEKL--FLED---PALQD---DLPISYLSHKELYEHSLRKACIIGEKIRKLRAD---GEDG 90
            |||.:||:  |.:.   |.:::   |..|    :|:|    |:||..:  |:..|:.|   |..|
 Worm    40 EKKLVEKVKNFAQSSVKPLVREMDRDARI----NKQL----LKKAFDL--KLMGLKIDPKYGGSG 94

  Fly    91 VDTYNALLG----GSLGSAILKEGNPLALHY--VMFVPTIMGQGTMDQQVEWLSKAWDC-EIIGT 148
            |..:..:|.    ..:..||     .|.:|.  .:..|.|...|..:.:.::|.|.  | :.:|.
 Worm    95 VSFFELVLAVEELSKIDPAI-----ALIMHLQNALVAPLIEEFGNEELKEKYLKKL--CKDSVGA 152

  Fly   149 YAQTELGHGTFLRGLETRADYDASTQEFVINTPSLSAYKWWPGGLGHT--ANHAVVVAQLYTKGE 211
            :|.:|:..|:....::|.|..|.  ..|::|     ..||   |:.:.  |:..:|:|....:..
 Worm   153 FALSEVVSGSDAFAMQTVAKKDG--DHFILN-----GSKW---GISNAPIADFFLVLANADPEKG 207

  Fly   212 FRGLAPFIVQLRDSDTHRPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVPLNNML---------- 266
            :||:..|||. ||.:      |:.:|:....|||:......:.|.:||||..:::          
 Worm   208 YRGVTCFIVD-RDHE------GVVLGEQDDNLGMRAGTIAQVHLNSVRVPKTSIVGEYGKGYKYA 265

  Fly   267 --MKNQQVLPDGTYVAPKNSVLTYGT------MMFVRCALIRDTAQSLAKASTIATRYSAVRRQS 323
              :.|...:..|..:..::.:....|      :|...||.::|......|.:::|..|:      
 Worm   266 IEVLNASRIVIGAQMGLQHQIAKIQTEIEAARLMVYNCARMKDCGMPFVKEASMAKYYA------ 324

  Fly   324 PIDPNQPEPQIMDHTTQQ 341
                    |::...||:|
 Worm   325 --------PEVACKTTKQ 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 77/343 (22%)
PLN02443 10..669 CDD:178062 77/343 (22%)
acdh-2NP_001343623.1 ACAD 38..379 CDD:324545 77/343 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.