DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and acdh-5

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_491942.1 Gene:acdh-5 / 172400 WormBaseID:WBGene00016491 Length:442 Species:Caenorhabditis elegans


Alignment Length:245 Identity:56/245 - (22%)
Similarity:95/245 - (38%) Gaps:43/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EERFKEKKALEKLFLE--DPAL----QDDLPISYLSHKELYEHSLRKACIIGEKIRKLRADGEDG 90
            |..|..:|:|.||..|  :|.:    ||....::|..|.|.:|.     :.|  :.|..|.|..|
 Worm    61 ETHFVMQKSLGKLIEEKINPNVAKWEQDGRYPAHLVFKMLGDHG-----VFG--VNKPEAFGGTG 118

  Fly    91 VD---------TYNALLGGSLGSAILKEGNPLALHYVMFVPTIMGQGTMDQQVEWLSKAWDCEII 146
            .|         ...|:..||:..:::.:.:       |..|.:...|:...:..:|..:...:::
 Worm   119 TDIAMATAIAEQMGAINCGSIPMSVMVQTD-------MSTPALAQFGSDALRERFLRPSITGDLV 176

  Fly   147 GTYAQTELGHGTFLRGLETRADYDASTQEFVINTPSLSAYKWWPGGLGHTANHAVVVAQLYTKGE 211
            .:.|.:|...|:.:..:.|.|....|  :.:||     ..|.|....|......|:|....|...
 Worm   177 SSLAVSEPHAGSDVSAVHTHARRQGS--DLIIN-----GSKMWITNGGQADWACVLVNTSNTSNV 234

  Fly   212 FRGLAPFIVQLRDSDTHRPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVP 261
            .:..:...|.|.....||..| :|      ||||:..:...|..::||||
 Worm   235 HKNKSLVCVPLDAVGVHRSTP-LD------KLGMRSSDTVQLFFEDVRVP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 56/245 (23%)
PLN02443 10..669 CDD:178062 56/245 (23%)
acdh-5NP_491942.1 CaiA 57..441 CDD:224871 56/245 (23%)
Acyl-CoA_dh_N 60..174 CDD:280866 27/126 (21%)
ACAD 149..430 CDD:173838 33/143 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.