DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and acdh-4

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_001300435.1 Gene:acdh-4 / 172367 WormBaseID:WBGene00020419 Length:385 Species:Caenorhabditis elegans


Alignment Length:249 Identity:61/249 - (24%)
Similarity:106/249 - (42%) Gaps:49/249 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LFLEDPALQDDL--PISYLSHKEL-YEHSLRKAC--IIGEKIRKLRADGE------DGVDTYNAL 97
            |....|..:||:  |:..||.:|. :..::|:..  :|...:|::....|      :|. ..|.|
 Worm    23 LLSSKPRNEDDIPHPLQVLSEQETGFVKTVRQFADTVIKPLVREMDRTSEMTPAVINGC-FENGL 86

  Fly    98 LG-------GSLGSA------ILKE--------GNPLALHYVMFVPTIMGQGTMDQQVEWLSKAW 141
            :|       |..|:.      :::|        |..:.:|..:|:|.|:..||..|:.::|.|.:
 Worm    87 MGIEVPEKYGGPGATFFDAALVIEEISKVDASVGAMVDVHNTLFIPLIIELGTEKQKEKYLPKCY 151

  Fly   142 DCEIIGTYAQTELGHGTFLRGLETRADYDASTQEFVINTPSLSAYKWWPGGLGHTANHAVVVAQL 206
            ... :|::|.:|.|.|:....|:|.|..|.  .::|||     ..|.|......:....|.....
 Worm   152 TSS-VGSFALSETGSGSDAFALKTTAKKDG--DDYVIN-----GSKMWISNSEQSETFLVFANAD 208

  Fly   207 YTKGEFRGLAPFIVQLRDSDTHRPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRV 260
            .:|| ::|:..|||:       :...|..||....|||::..:...|...||||
 Worm   209 PSKG-YKGITCFIVE-------KGTKGFTIGKHEDKLGVRSSSTCPLHFDNVRV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 61/249 (24%)
PLN02443 10..669 CDD:178062 61/249 (24%)
acdh-4NP_001300435.1 CaiA 41..359 CDD:224871 56/231 (24%)
ACAD 43..359 CDD:299127 54/229 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163663
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.