DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and Acads

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_031409.2 Gene:Acads / 11409 MGIID:87868 Length:412 Species:Mus musculus


Alignment Length:417 Identity:83/417 - (19%)
Similarity:165/417 - (39%) Gaps:80/417 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 SHKELY--------EHSLRKACIIGEKIRKLRADGEDGVDTYNALLGGSLG----SAILKE---- 109
            :.|||.        ||....|     :::|:...|...:|....|.|..|.    |..|:|    
Mouse    49 AEKELVPIAAQLDREHLFPTA-----QVKKMGELGLLAMDVPEELSGAGLDYLAYSIALEEISRA 108

  Fly   110 ----GNPLALHYVMFVPTIMGQGTMDQQVEWLSKAWDCEIIGTYAQTELGHGTFLRGLETRADYD 170
                |..::::..:::..|:..|:..|:.:|::...:.:.||.:|.:|.|:|:......|.|..:
Mouse   109 CASTGVIMSVNNSLYLGPILKFGSAQQKQQWITPFTNGDKIGCFALSEPGNGSDAGAASTTAREE 173

  Fly   171 ASTQEFVIN-TPSLSAYKWWPGGLGHTANHAVVVAQLYTKGEFRGLAPFIVQLRDSDTHRPMPGI 234
            ..:  :|:| |.:.....|       .|:..||.|......:.:|::.|:|.:       |.||:
Mouse   174 GDS--WVLNGTKAWITNSW-------EASATVVFASTDRSRQNKGISAFLVPM-------PTPGL 222

  Fly   235 DIGDIGTKLGMKGVNNGYLGLKNVRVPLNNMLMKNQQVLPDGTYVAPKNSVLTYGTMMFVRCALI 299
            .:|....|||::..:...|..::.|:|..|:|.:...    |..:|.:       |:...|.. |
Mouse   223 TLGKKEDKLGIRASSTANLIFEDCRIPKENLLGEPGM----GFKIAMQ-------TLDMGRIG-I 275

  Fly   300 RDTAQSLAKAS-TIATRYSAVRRQ--SPIDPNQPEPQIMDHTTQQLKLFPQIAKAIVFKTTGDGI 361
            ...|..:|:|| ..|.:|:..|..  :|:    .:.|.:......:.|..:.|:.:.::..    
Mouse   276 ASQALGIAQASLDCAVKYAENRNAFGAPL----TKLQNIQFKLADMALALESARLLTWRAA---- 332

  Fly   362 WNMYNVISGEIEQGNLDRLPEMHALSCCLKAICSADAAAGVETCRLS-CGGHGYMDCSNFPTIYG 425
                      :.:.|.....:..|::    .:.:::||..:....:. .||.||:........|.
Mouse   333 ----------MLKDNKKPFTKESAMA----KLAASEAATAISHQAIQILGGMGYVTEMPAERYYR 383

  Fly   426 MTTAVCTYEGENTVMLLQTARYLVKVY 452
            .......|||.:.:..|..|.:|::.|
Mouse   384 DARITEIYEGTSEIQRLVIAGHLLRSY 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 83/417 (20%)
PLN02443 10..669 CDD:178062 83/417 (20%)
AcadsNP_031409.2 SCAD_SBCAD 36..408 CDD:173847 82/413 (20%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P15651 269..272 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.