DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and Acadm

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:NP_031408.1 Gene:Acadm / 11364 MGIID:87867 Length:421 Species:Mus musculus


Alignment Length:201 Identity:53/201 - (26%)
Similarity:87/201 - (43%) Gaps:47/201 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 ACIIGEKIRKLRADGEDGVDTYNALLGGSLGSAILKEGNPLALHYVMFVPTIMGQGTMDQQVEWL 137
            ||:|.|::    |.|..||.|  |:...|||.                :|.|:. |...|:.::|
Mouse   105 ACLITEEL----AYGCTGVQT--AIEANSLGQ----------------MPVILA-GNDQQKKKYL 146

  Fly   138 SKAWDCEIIGTYAQTELGHGTFLRGLETRADYDASTQEFVINTPSLSAYKWWPGGLGHTANHAVV 202
            .:..:..::..|..||...|:.:..::|:|  :....|:|||     ..|.|... |..||...:
Mouse   147 GRMTEQPMMCAYCVTEPSAGSDVAAIKTKA--EKKGDEYVIN-----GQKMWITN-GGKANWYFL 203

  Fly   203 VA------QLYTKGEFRGLAPFIVQLRDSDTHRPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVP 261
            :|      ::.....|.|   |||   ::||    |||.||.....:|.:..:...:..::||||
Mouse   204 LARSNPDPKVPASKAFTG---FIV---EADT----PGIHIGKKELNMGQRCSDTRGIAFEDVRVP 258

  Fly   262 LNNMLM 267
            ..|:|:
Mouse   259 KENVLI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 53/201 (26%)
PLN02443 10..669 CDD:178062 53/201 (26%)
AcadmNP_031408.1 CaiA 39..420 CDD:224871 53/201 (26%)
MCAD 41..418 CDD:173846 53/201 (26%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:P41367 278..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.