Sequence 1: | NP_611264.2 | Gene: | CG5009 / 37028 | FlyBaseID: | FBgn0027572 | Length: | 669 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_031408.1 | Gene: | Acadm / 11364 | MGIID: | 87867 | Length: | 421 | Species: | Mus musculus |
Alignment Length: | 201 | Identity: | 53/201 - (26%) |
---|---|---|---|
Similarity: | 87/201 - (43%) | Gaps: | 47/201 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 73 ACIIGEKIRKLRADGEDGVDTYNALLGGSLGSAILKEGNPLALHYVMFVPTIMGQGTMDQQVEWL 137
Fly 138 SKAWDCEIIGTYAQTELGHGTFLRGLETRADYDASTQEFVINTPSLSAYKWWPGGLGHTANHAVV 202
Fly 203 VA------QLYTKGEFRGLAPFIVQLRDSDTHRPMPGIDIGDIGTKLGMKGVNNGYLGLKNVRVP 261
Fly 262 LNNMLM 267 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5009 | NP_611264.2 | AXO | 8..645 | CDD:173839 | 53/201 (26%) |
PLN02443 | 10..669 | CDD:178062 | 53/201 (26%) | ||
Acadm | NP_031408.1 | CaiA | 39..420 | CDD:224871 | 53/201 (26%) |
MCAD | 41..418 | CDD:173846 | 53/201 (26%) | ||
Substrate binding. /evidence=ECO:0000250|UniProtKB:P41367 | 278..281 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1960 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |