DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5009 and vps53

DIOPT Version :9

Sequence 1:NP_611264.2 Gene:CG5009 / 37028 FlyBaseID:FBgn0027572 Length:669 Species:Drosophila melanogaster
Sequence 2:XP_002934389.2 Gene:vps53 / 100496110 XenbaseID:XB-GENE-1011610 Length:830 Species:Xenopus tropicalis


Alignment Length:136 Identity:26/136 - (19%)
Similarity:51/136 - (37%) Gaps:41/136 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   568 LYLVDACL-NRIGDFLRFIDLTDQDVTK--------LEVRL------------------------ 599
            ::.||.|: .||.  :.|..:|..|::|        :||:|                        
 Frog   304 MFPVDWCMTERIA--VEFCHITRNDLSKIMRTRAKEIEVKLLLFAIQRTTNFEGLLAKRFSGSTL 366

  Fly   600 -ENCLKRFRPNAVSLVDSFDLHDRVLDSALGAYDGNVYEHIFESTKKNPLNKEPVNGAFHKYLKP 663
             :|.:|:..|......:.|...|.:.|.::...|.::     :..||..|.:.|.:|...|..:|
 Frog   367 SDNVVKKPDPQPPVSTNPFLDDDNLTDESVLDKDSDL-----DKPKKPKLPENPFHGIISKCFEP 426

  Fly   664 FMKAHL 669
            .:..::
 Frog   427 HLYVYI 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5009NP_611264.2 AXO 8..645 CDD:173839 19/110 (17%)
PLN02443 10..669 CDD:178062 26/134 (19%)
vps53XP_002934389.2 Vps53_N 38..452 CDD:282020 26/136 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.