DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and MSC

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_005089.2 Gene:MSC / 9242 HGNCID:7321 Length:206 Species:Homo sapiens


Alignment Length:70 Identity:43/70 - (61%)
Similarity:50/70 - (71%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAVETGSHSQNH 96
            ||||||||||.||||||.|:.||||.||.:|||||||||||||||:.||..|...::...:...:
Human   108 QRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYENGY 172

  Fly    97 PHNHN 101
            .|..|
Human   173 VHPVN 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 40/50 (80%)
MSCNP_005089.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115 6/6 (100%)
Nuclear localization signal. /evidence=ECO:0000255 71..76
bHLH_TS_musculin 105..170 CDD:381546 41/61 (67%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149609
Domainoid 1 1.000 81 1.000 Domainoid score I8521
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004410
OrthoInspector 1 1.000 - - otm40971
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5029
SonicParanoid 1 1.000 - - X3129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.