DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and msgn1

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001039104.1 Gene:msgn1 / 733924 XenbaseID:XB-GENE-972085 Length:172 Species:Xenopus tropicalis


Alignment Length:71 Identity:20/71 - (28%)
Similarity:37/71 - (52%) Gaps:2/71 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 EDASSQSSQPPVQRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTK--LSKLDTLRLATLYIKQ 82
            :|...:.|....:|..|:.||::|||.::.|...|:..||.:....:  |:|:.||:....||.:
 Frog    97 KDHGHKPSMTVQRRRKASEREKLRMRAIAEALHTLRNNLPPMYSQGRQPLTKIQTLKCTINYISE 161

  Fly    83 LITAVE 88
            |...::
 Frog   162 LTNLLQ 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 17/52 (33%)
msgn1NP_001039104.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69
bHLH_TS_Msgn1 102..167 CDD:381509 19/64 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.