DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and TCF21

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_003197.2 Gene:TCF21 / 6943 HGNCID:11632 Length:179 Species:Homo sapiens


Alignment Length:108 Identity:56/108 - (51%)
Similarity:65/108 - (60%) Gaps:17/108 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRK------KRSSSPTEFFDDDFDEDASSQSSQ--PPVQRNAANARERMRMRVLSSAYGRLKTKL 58
            |:|      ||..:||:       :...|..||  ..|||||||||||.||||||.|:.||||.|
Human    49 PQKGRGGLGKRRKAPTK-------KSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTL 106

  Fly    59 PNIPPDTKLSKLDTLRLATLYIKQL--ITAVETGSHSQNHPHN 99
            |.:|||||||||||||||:.||..|  |.|.:...:...||.|
Human   107 PWVPPDTKLSKLDTLRLASSYIAHLRQILANDKYENGYIHPVN 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 40/50 (80%)
TCF21NP_003197.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..87 16/44 (36%)
bHLH_TS_TCF21_capsulin 77..140 CDD:381547 44/62 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149616
Domainoid 1 1.000 81 1.000 Domainoid score I8521
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004410
OrthoInspector 1 1.000 - - otm40971
orthoMCL 1 0.900 - - OOG6_107588
Panther 1 1.100 - - O PTHR23349
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5029
SonicParanoid 1 1.000 - - X3129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.