DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and Tcf24

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_008761741.2 Gene:Tcf24 / 680678 RGDID:1589398 Length:170 Species:Rattus norvegicus


Alignment Length:76 Identity:33/76 - (43%)
Similarity:45/76 - (59%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ASSQSSQPPVQRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITA 86
            |:...|..|...||  ||||.|::.|..|:..|:..||::||||||||||.|.|||.||..|..:
  Rat    45 AARSGSGRPAAANA--ARERSRVQTLRHAFLELQRTLPSVPPDTKLSKLDVLLLATTYIAHLTRS 107

  Fly    87 VETGSHSQNHP 97
            ::..:.:...|
  Rat   108 LQDDTDAPGDP 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 28/50 (56%)
Tcf24XP_008761741.2 bHLH_TS_TCF24 53..108 CDD:381553 30/56 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.