DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and msc

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_684279.3 Gene:msc / 556396 -ID:- Length:160 Species:Danio rerio


Alignment Length:137 Identity:55/137 - (40%)
Similarity:74/137 - (54%) Gaps:35/137 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DDDFDED--------------ASSQSSQPPV---------QRNAANARERMRMRVLSSAYGRLKT 56
            :|||..|              |:|.:::|.:         ||||||||||.||||||.|:.||||
Zfish    23 EDDFSLDDGLKPKPKSKTPRGAASNTNKPQMKLAKDGRQSQRNAANARERARMRVLSKAFSRLKT 87

  Fly    57 KLPNIPPDTKLSKLDTLRLATLYI---KQLITAVETGSHSQNHPHNHNQHHSLNHSHSSTTSSEG 118
            .||.:|.|||||||||||||:.||   :||:         |:..:::|..|..|.:.....|:..
Zfish    88 SLPWVPADTKLSKLDTLRLASSYISHLRQLL---------QDDTYHNNLAHPANLTWPFVVSARS 143

  Fly   119 LDTSHMA 125
            .||..::
Zfish   144 EDTKDIS 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 39/53 (74%)
mscXP_684279.3 HLH 68..120 CDD:197674 36/60 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583760
Domainoid 1 1.000 81 1.000 Domainoid score I8465
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004410
OrthoInspector 1 1.000 - - otm25659
orthoMCL 1 0.900 - - OOG6_107588
Panther 1 1.100 - - LDO PTHR23349
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5029
SonicParanoid 1 1.000 - - X3129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.960

Return to query results.
Submit another query.