DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and twi

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001033967.1 Gene:twi / 37655 FlyBaseID:FBgn0003900 Length:490 Species:Drosophila melanogaster


Alignment Length:118 Identity:41/118 - (34%)
Similarity:57/118 - (48%) Gaps:30/118 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRK--KRSSSPTEFFDDDFDEDASSQSSQPPVQRNAANARERMRMRVLSSAYGRLKTKLPNIPPD 64
            ||:  ||..|.||    :.||.::        ||..||.|||.|.:.|:.|:..|:..:|.:|.|
  Fly   343 PRRRLKRKPSKTE----ETDEFSN--------QRVMANVRERQRTQSLNDAFKSLQQIIPTLPSD 395

  Fly    65 TKLSKLDTLRLATLYIK-----------QLITAVETGSHSQNHPHNHNQHHSL 106
             ||||:.||:|||.||.           .|:.|:|    :|..|..:....||
  Fly   396 -KLSKIQTLKLATRYIDFLCRMLSSSDISLLKALE----AQGSPSAYGSASSL 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 25/61 (41%)
twiNP_001033967.1 HLH 363..413 CDD:278439 25/50 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.