DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and Bhlha9

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_038943763.1 Gene:Bhlha9 / 363656 RGDID:1311234 Length:230 Species:Rattus norvegicus


Alignment Length:104 Identity:30/104 - (28%)
Similarity:48/104 - (46%) Gaps:6/104 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DEDASSQSSQPP----VQRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLY 79
            :|:.:.:..:.|    .:|.|||.|||.|:...:.|:..|:..|.:.....:|||:.|||.|...
  Rat    44 EEEVAGRKRERPARSKARRMAANVRERKRILDYNEAFNALRRALQHDLGGKRLSKIATLRRAIHR 108

  Fly    80 IKQLITAVETGSHSQNHPHNHNQHHSLNHSHSSTTSSEG 118
            |..| :.|...|.:...|..|.:.|. ..:|.|:....|
  Rat   109 ITAL-SLVLRASPAPRWPCGHLECHG-QAAHGSSAGDSG 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 19/50 (38%)
Bhlha9XP_038943763.1 bHLH_TS_bHLHa9 54..116 CDD:381482 21/62 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.