DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and bhlha9

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001189344.1 Gene:bhlha9 / 323481 ZFINID:ZDB-GENE-030131-2201 Length:260 Species:Danio rerio


Alignment Length:241 Identity:52/241 - (21%)
Similarity:79/241 - (32%) Gaps:76/241 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DEDASSQSSQP---PVQRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYI 80
            :|....:.|:|   ..:|.|||.|||.|:...:.|:..|:..|.:.....:|||:.||:.|...|
Zfish    49 EERLIKKRSRPVRSKARRVAANVRERKRILDYNQAFNALRVALHHDLSGKRLSKIATLQRAINRI 113

  Fly    81 KQLITAVETGSHSQNHPHNHNQHHSLNHSHSSTTSSEGLDTSHMADSSGG-------GNYNFHNN 138
            ..|...:      .|:|                .........|:....||       ...||   
Zfish   114 SALSVFL------TNNP----------------PVGVAKPCGHLECQPGGLWAEAEPSMQNF--- 153

  Fly   139 GHGMSWPFEFHQSSRSLAFAPSSSTTSSARMDWQTLHTQSYPKTTRGETHVSADLSYHQLPESHS 203
               ::|    ||....                    |.|:.......|.||....:..  |..| 
Zfish   154 ---LTW----HQPLNQ--------------------HLQTSIHRLSSEQHVFTGPACP--PSPH- 188

  Fly   204 HWYP--AEVHQMEPAASCSYD------SGMGQHQRGIAIATSHAHG 241
              ||  :..:|:.||||....      ..:|.:|:|: ...:||.|
Zfish   189 --YPCFSPDNQLYPAASVPSPPRYGRIGDVGAYQQGV-WGGNHADG 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 18/50 (36%)
bhlha9NP_001189344.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 17..49 52/241 (22%)
HLH 65..116 CDD:278439 18/50 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583770
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.