powered by:
Protein Alignment HLH54F and Msc
DIOPT Version :9
Sequence 1: | NP_477302.1 |
Gene: | HLH54F / 37027 |
FlyBaseID: | FBgn0022740 |
Length: | 242 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_008761698.1 |
Gene: | Msc / 312897 |
RGDID: | 1305496 |
Length: | 220 |
Species: | Rattus norvegicus |
Alignment Length: | 70 |
Identity: | 43/70 - (61%) |
Similarity: | 51/70 - (72%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 QRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAVETGSHSQNH 96
||||||||||.||||||.|:.||||.||.:|||||||||||||||:.||..|...::...:..::
Rat 105 QRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYEDSY 169
Fly 97 PHNHN 101
.|..|
Rat 170 VHPVN 174
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C166343493 |
Domainoid |
1 |
1.000 |
81 |
1.000 |
Domainoid score |
I8315 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004410 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm45105 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR23349 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3129 |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
8 | 7.930 |
|
Return to query results.
Submit another query.