DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and Msc

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_008761698.1 Gene:Msc / 312897 RGDID:1305496 Length:220 Species:Rattus norvegicus


Alignment Length:70 Identity:43/70 - (61%)
Similarity:51/70 - (72%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAVETGSHSQNH 96
            ||||||||||.||||||.|:.||||.||.:|||||||||||||||:.||..|...::...:..::
  Rat   105 QRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYEDSY 169

  Fly    97 PHNHN 101
            .|..|
  Rat   170 VHPVN 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 40/50 (80%)
MscXP_008761698.1 bHLH_TS_musculin 102..167 CDD:381546 41/61 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343493
Domainoid 1 1.000 81 1.000 Domainoid score I8315
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004410
OrthoInspector 1 1.000 - - otm45105
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR23349
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3129
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.