DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and HLH3B

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_525055.1 Gene:HLH3B / 31249 FlyBaseID:FBgn0011276 Length:376 Species:Drosophila melanogaster


Alignment Length:229 Identity:56/229 - (24%)
Similarity:93/229 - (40%) Gaps:47/229 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VQRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAV------ET 89
            |::...|.|||.|.:.:|.|:..|:..:|..|||.||||.:.||.|..||| |:|.:      :.
  Fly   165 VRKVFTNTRERWRQQNVSGAFAELRKLVPTHPPDKKLSKNEILRSAIKYIK-LLTGILEWQQRQA 228

  Fly    90 GSH---SQNHPHNHNQHHSLNHSHSSTTSSEGLD------TSHMADSSGGGNYNFHNNGHGMSWP 145
            .||   :|..|:|::...:..|:    ...|.|:      ..|:......|..:.:..|||    
  Fly   229 PSHPIRAQMEPNNNDNRMANGHA----ADGENLENPDVPPVRHIKCERTDGQMHRNGIGHG---- 285

  Fly   146 FEFHQSSRS----LAFAPSSSTTSSARMD-----WQTLHTQSYPKTT----RGET-HVSADLSYH 196
               |.:..:    |..||.:...|...::     ...|:....|.||    ..|| .:|..:|..
  Fly   286 ---HANGNAGNDLLMIAPGAVVKSELLLESTLPLGHPLNGPPLPLTTAPLAMAETQRISGTVSGV 347

  Fly   197 QLPESHSHWYPAEVHQMEPAASCSYDSGMGQHQR 230
            :.....|     ...:::|....: |..:|:.:|
  Fly   348 KSASGRS-----SKRRLKPEGGAT-DLSLGKRRR 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 22/50 (44%)
HLH3BNP_525055.1 HLH 171..222 CDD:197674 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.