DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and sc

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_476803.1 Gene:sc / 30982 FlyBaseID:FBgn0004170 Length:345 Species:Drosophila melanogaster


Alignment Length:295 Identity:71/295 - (24%)
Similarity:106/295 - (35%) Gaps:96/295 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRKKRSSSPTEFFDDDFDEDASSQS--SQP---------PVQRNAANARERMRMRVLSSAYGRL 54
            ||.|.|..:|.........|..||.|  |.|         .|||.  |||||.|::.:::::.||
  Fly    60 MPIKTRKYTPRGMALTRCSESVSSLSPGSSPAPYNVDQSQSVQRR--NARERNRVKQVNNSFARL 122

  Fly    55 KTKLPNI-----------PPDTKLSKLDTLRLATLYIKQLITAV--------------------- 87
            :..:|..           .|..|:||:||||:|..||::|...|                     
  Fly   123 RQHIPQSIITDLTKGGGRGPHKKISKVDTLRIAVEYIRRLQDLVDDLNGGSNIGANNAVTQLQLC 187

  Fly    88 --ETGSHSQN----HPHNHN------------------QHHSLNHSHSSTTSSEGLDTSHMADSS 128
              |:.|||.:    ....||                  |....||...:..|   |:|:.:..|.
  Fly   188 LDESSSHSSSSSTCSSSGHNTYYQNTISVSPLQQQQQLQRQQFNHQPLTALS---LNTNLVGTSV 249

  Fly   129 GGGNYNFHNNGHGMSWPFEFHQSSRSLAFAPSSSTTSSARMDWQTLHTQSYPKTTRGETHVSADL 193
            .||:....:.           ..::....:|:||..||...|..|.  :..|:..  .||:  |.
  Fly   250 PGGDAGCVST-----------SKNQQTCHSPTSSFNSSMSFDSGTY--EGVPQQI--STHL--DR 297

  Fly   194 SYHQLPESHSH------WYPAEVHQMEPAASCSYD 222
            ..|...|.|:|      :.|.|..|:: ...|:.|
  Fly   298 LDHLDNELHTHSQLQLKFEPYEHFQLD-EEDCTPD 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 22/61 (36%)
scNP_476803.1 HLH 105..163 CDD:278439 20/57 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.