DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and Mesp1

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001101001.1 Gene:Mesp1 / 308766 RGDID:1311751 Length:242 Species:Rattus norvegicus


Alignment Length:260 Identity:52/260 - (20%)
Similarity:88/260 - (33%) Gaps:100/260 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRKKRSSSPTEFFDDDF-------DEDASSQSSQPPV-------------------------QRN 34
            |.:.:.|.|::  .|.|       |....:|:|.|.:                         ||.
  Rat    17 PARPQPSMPSD--GDSFCSPAWSSDSWDGAQASSPALPCARPARRAGTPGRRGTHGSRLGSGQRQ 79

  Fly    35 AANARERMRMRVLSSAYGRLKTKLPN--IPPDTKLSKLDTLRLATLYIKQLITAVETGSHSQNHP 97
            :|:.||::|||.|:.|...|:..||.  .|....|:|::|||||..||..|...:.....|.   
  Rat    80 SASEREKLRMRTLARALHELRRFLPPSVAPIGQNLTKIETLRLAIRYIGHLSAVLGLSEDSL--- 141

  Fly    98 HNHNQHHSLNHSHSSTTSSEGLDTSHMADSSGGGNYNFHNNGHGMSWPFEFHQSSRSLAFAPSSS 162
              ..|.|:::..........||                                :::.:..|..|
  Rat   142 --RQQRHAVSPRGCPLCPDSGL--------------------------------AQAQSLGPHLS 172

  Fly   163 TTSSARMDWQTLHTQSYPKTTRGETHVSADLSYHQLPESHSHWYPA---------EVHQMEPAAS 218
            ..:.:.:.|.:  :.:||:     ..|:|:           .|.|:         |..:|||:.|
  Rat   173 PVACSGVSWGS--SPAYPR-----PRVAAE-----------SWDPSFLYTETASLERQEMEPSPS 219

  Fly   219  218
              Rat   220  219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 23/52 (44%)
Mesp1NP_001101001.1 HLH 77..130 CDD:278439 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.