powered by:
Protein Alignment HLH54F and tcf15
DIOPT Version :9
Sequence 1: | NP_477302.1 |
Gene: | HLH54F / 37027 |
FlyBaseID: | FBgn0022740 |
Length: | 242 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_571047.1 |
Gene: | tcf15 / 30159 |
ZFINID: | ZDB-GENE-980605-20 |
Length: | 183 |
Species: | Danio rerio |
Alignment Length: | 67 |
Identity: | 32/67 - (47%) |
Similarity: | 45/67 - (67%) |
Gaps: | 1/67 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 QRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAVETGSHSQN- 95
||||||||||.|.:.:::|:..|:|.:|..|.|.||||::|||||:.||..|...:..|...::
Zfish 65 QRNAANARERDRTQSVNTAFTALRTLIPTEPVDRKLSKIETLRLASSYISHLANVLLIGDGGEDA 129
Fly 96 HP 97
||
Zfish 130 HP 131
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HLH54F | NP_477302.1 |
HLH |
32..83 |
CDD:278439 |
28/50 (56%) |
tcf15 | NP_571047.1 |
HLH |
65..116 |
CDD:278439 |
28/50 (56%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170583771 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.830 |
|
Return to query results.
Submit another query.