DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and Fer1

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:235 Identity:59/235 - (25%)
Similarity:82/235 - (34%) Gaps:105/235 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSSPTEFFDD------DFDEDASSQ----------------------------SSQPPVQRNAAN 37
            :||...||.|      |.::||.|.                            :||...||.|||
  Fly    28 TSSSDYFFGDEHSSESDDEDDAYSSGFNSDQENTEKTFCPFSRRSHKPRRLKCASQMAQQRQAAN 92

  Fly    38 ARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYI---------------------- 80
            .|||.||:.::.|:..|:|.:|.:|.:.:|||:|||:||..||                      
  Fly    93 LRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNEPGLSLQR 157

  Fly    81 -------KQLITAVETGS--------------------------------HSQNHP----HNHNQ 102
                   |::|....||.                                |||..|    .|.||
  Fly   158 NYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGSKLYARTWTPEDPRGPHSQPLPLYNNSNSNQ 222

  Fly   103 HHSLNHSHSSTTSSEGLDTSHMADSSGGGNYNFHNNGHGM 142
            :.:.|.| |...|..|.|   |:|.  |...:..::|.||
  Fly   223 NQNSNQS-SDDFSGSGAD---MSDP--GAAASIFSSGSGM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 26/79 (33%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452820
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23349
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.