DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and Ascl2

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_113691.1 Gene:Ascl2 / 24209 RGDID:2159 Length:260 Species:Rattus norvegicus


Alignment Length:80 Identity:26/80 - (32%)
Similarity:42/80 - (52%) Gaps:13/80 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKRSSSPTEFFDDDFDEDASSQSSQPPVQRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLS 68
            ::|.|..||           :.||...|.|.  |.|||.|:::::..:..|:..:|:...:.|||
  Rat   104 RRRRSGATE-----------ASSSSAAVARR--NERERNRVKLVNLGFQALRQHVPHGGANKKLS 155

  Fly    69 KLDTLRLATLYIKQL 83
            |::|||.|..||:.|
  Rat   156 KVETLRSAVEYIRAL 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 18/50 (36%)
Ascl2NP_113691.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..126 9/34 (26%)
HLH 134..176 CDD:197674 13/37 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 191..239
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.