DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and Twist1

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_035788.1 Gene:Twist1 / 22160 MGIID:98872 Length:206 Species:Mus musculus


Alignment Length:97 Identity:32/97 - (32%)
Similarity:50/97 - (51%) Gaps:8/97 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ASSQSSQP------PVQRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYI 80
            :||....|      ..||..||.|||.|.:.|:.|:..|:..:|.:|.| ||||:.||:||..||
Mouse    97 SSSGGGSPQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSD-KLSKIQTLKLAARYI 160

  Fly    81 KQLITAVETGS-HSQNHPHNHNQHHSLNHSHS 111
            ..|...:::.. .|:....::..|..|:::.|
Mouse   161 DFLYQVLQSDELDSKMASCSYVAHERLSYAFS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 24/50 (48%)
Twist1NP_035788.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..109 3/11 (27%)
HLH 113..163 CDD:306515 24/50 (48%)
Sufficient for transactivation activity 165..195 4/28 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839674
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.