DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and Tcf21

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_035675.1 Gene:Tcf21 / 21412 MGIID:1202715 Length:179 Species:Mus musculus


Alignment Length:108 Identity:56/108 - (51%)
Similarity:65/108 - (60%) Gaps:17/108 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PRK------KRSSSPTEFFDDDFDEDASSQSSQ--PPVQRNAANARERMRMRVLSSAYGRLKTKL 58
            |:|      ||..:||:       :...|..||  ..|||||||||||.||||||.|:.||||.|
Mouse    49 PQKGRGGLGKRRKAPTK-------KSPLSGVSQEGKQVQRNAANARERARMRVLSKAFSRLKTTL 106

  Fly    59 PNIPPDTKLSKLDTLRLATLYIKQL--ITAVETGSHSQNHPHN 99
            |.:|||||||||||||||:.||..|  |.|.:...:...||.|
Mouse   107 PWVPPDTKLSKLDTLRLASSYIAHLRQILANDKYENGYIHPVN 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 40/50 (80%)
Tcf21NP_035675.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..88 17/45 (38%)
HLH 80..132 CDD:278439 40/51 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839678
Domainoid 1 1.000 81 1.000 Domainoid score I8494
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004410
OrthoInspector 1 1.000 - - otm43042
orthoMCL 1 0.900 - - OOG6_107588
Panther 1 1.100 - - O PTHR23349
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5029
SonicParanoid 1 1.000 - - X3129
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.