DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and Tal2

DIOPT Version :10

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_033343.1 Gene:Tal2 / 21350 MGIID:99540 Length:108 Species:Mus musculus


Alignment Length:66 Identity:26/66 - (39%)
Similarity:40/66 - (60%) Gaps:6/66 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAV------ETGSHSQN 95
            |.|||.|.:.:::|:.:|:..:|..|||.||||.:|||||..||..|:..:      :||..:|.
Mouse     8 NTRERWRQQSVNNAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLHQTGVAAQG 72

  Fly    96 H 96
            :
Mouse    73 N 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 bHLH_TS_musculin_like 32..87 CDD:381429 23/49 (47%)
Tal2NP_033343.1 bHLH_SF 2..62 CDD:469605 23/53 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 76..108
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.