DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HLH54F and Ptf1a

DIOPT Version :9

Sequence 1:	NP_477302.1	Gene:	HLH54F / 37027	FlyBaseID:	FBgn0022740	Length:	242	Species:	Drosophila melanogaster
Sequence 2:	NP_061279.2	Gene:	Ptf1a / 19213	MGIID:	1328312	Length:	324	Species:	Mus musculus

Alignment Length:	135	Identity:	40/135 - (29%)
Similarity:	56/135 - (41%)	Gaps:	33/135 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly    33 RNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAVET-------- 89
            |.|||.|||.||:.::.|:..|::.:|.:|.:.:|||:||||||..||..|...|:.
Mouse   162 RQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSG 226

  Fly    90 --------GSHSQNHPHNHNQHHSLNHSHSSTTSSEGLDTSH----MADSSGGGNYNFHNNGHGM 142
                    ||.........||...:...|..|.|....|..:    :|             ||.:
Mouse   227 AGGCGGPGGSRHLGEDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLA-------------GHSL 278

  Fly   143 SWPFE 147
            ||..|
Mouse   279 SWTDE 283

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HLH54F	NP_477302.1	HLH	32..83	CDD:278439	24/49 (49%)
Ptf1a	NP_061279.2	HLH	162..217	CDD:238036	25/54 (46%)
Ptf1a	NP_061279.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	302..324
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4029
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900