powered by:
Protein Alignment HLH54F and hlh-10
DIOPT Version :9
Sequence 1: | NP_477302.1 |
Gene: | HLH54F / 37027 |
FlyBaseID: | FBgn0022740 |
Length: | 242 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_505401.2 |
Gene: | hlh-10 / 191402 |
WormBaseID: | WBGene00001954 |
Length: | 202 |
Species: | Caenorhabditis elegans |
Alignment Length: | 63 |
Identity: | 26/63 - (41%) |
Similarity: | 40/63 - (63%) |
Gaps: | 1/63 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 QRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAVETGSHSQ 94
:|..||||||.|::.||..:.:|:..|| |..|.|:|||.||::|:.||..|...::..|:.:
Worm 122 RRYEANARERNRVQQLSKMFDQLRVCLP-IEDDAKISKLATLKVASSYIGYLGAILQENSNDE 183
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
HLH54F | NP_477302.1 |
HLH |
32..83 |
CDD:278439 |
24/50 (48%) |
hlh-10 | NP_505401.2 |
bHLH_SF |
121..179 |
CDD:381792 |
25/57 (44%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4029 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_107588 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR23349 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5029 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.930 |
|
Return to query results.
Submit another query.