Sequence 1: | NP_477302.1 | Gene: | HLH54F / 37027 | FlyBaseID: | FBgn0022740 | Length: | 242 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001379767.1 | Gene: | cnd-1 / 183212 | WormBaseID: | WBGene00000561 | Length: | 192 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 55/199 - (27%) |
---|---|---|---|
Similarity: | 83/199 - (41%) | Gaps: | 30/199 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 DFDEDASSQSSQPPVQRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIK 81
Fly 82 QLITAVETGSHSQNHPHNHNQHHSLNHSHSSTTSS-----------EGLDTSHMADSSGGGNYNF 135
Fly 136 HNNGHGMSWPFEFHQSSRSLAFAPSSSTTSSARMDWQTLHTQSYPKTTRGETHVSADLSYHQLPE 200
Fly 201 SHSH 204 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HLH54F | NP_477302.1 | HLH | 32..83 | CDD:278439 | 23/50 (46%) |
cnd-1 | NP_001379767.1 | bHLH_TS_NeuroD | 21..75 | CDD:381433 | 24/53 (45%) |
Neuro_bHLH | 78..>129 | CDD:403655 | 9/50 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 52 | 1.000 | Inparanoid score | I4096 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |