DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and cnd-1

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001379767.1 Gene:cnd-1 / 183212 WormBaseID:WBGene00000561 Length:192 Species:Caenorhabditis elegans


Alignment Length:199 Identity:55/199 - (27%)
Similarity:83/199 - (41%) Gaps:30/199 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 DFDEDASSQSSQPPVQRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIK 81
            |....|.::.|:..|:|..||.|||.||..|::|...|:..:|......||||::|||||..||.
 Worm     5 DTSNFAPAEISKRKVRRVKANGRERARMHGLNNALDMLREYIPITTQHQKLSKIETLRLARNYID 69

  Fly    82 QLITAVETGSHSQNHPHNHNQHHSLNHSHSSTTSS-----------EGLDTSHMADSSGGGNYNF 135
            .|...::|    ...|......|:|.:..|.||::           :.|..|.....|...::..
 Worm    70 ALQRMLQT----NEQPTPLEYAHTLANGLSQTTTNMLANLLQVQPRQLLPPSQFDIFSDPSHHQL 130

  Fly   136 HNNGHGMSWPFEFHQSSRSLAFAPSSSTTSSARMDWQTLHTQSYPKTTRGETHVSADLSYHQLPE 200
            |.:          |....| :|:.||.::|.:...:....||......:|    |.|..|.|:..
 Worm   131 HPS----------HPPPHS-SFSSSSPSSSCSPPQYYYSPTQPSAAPLQG----SCDPQYQQMYH 180

  Fly   201 SHSH 204
            .|||
 Worm   181 QHSH 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 23/50 (46%)
cnd-1NP_001379767.1 bHLH_TS_NeuroD 21..75 CDD:381433 24/53 (45%)
Neuro_bHLH 78..>129 CDD:403655 9/50 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I4096
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.