DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and hlh-14

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_495131.3 Gene:hlh-14 / 182758 WormBaseID:WBGene00001958 Length:148 Species:Caenorhabditis elegans


Alignment Length:161 Identity:37/161 - (22%)
Similarity:66/161 - (40%) Gaps:37/161 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 AANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQL-----------ITAVE 88
            |.|.|||.|:..::..:..|:.:|.......|.||.||||.|..||:||           ..:..
 Worm     8 ARNERERKRVHQVNHGFDVLRNRLQPKNHTKKWSKADTLREAVKYIQQLQVLLNQDPQQPSVSSS 72

  Fly    89 TGSHSQNHPHNHNQHHSLNHSHSSTTSSEGLDTSHMADSSGGGNYNFHNNGHGMSWPFEFHQSSR 153
            |..::.|:.:|.| ::::....|..........:.|:...|..::||:                 
 Worm    73 TPDYTMNNSNNFN-NYAVKEEFSMYLPQNYCPQNQMSVPHGDVSHNFN----------------- 119

  Fly   154 SLAFAPSSSTTSSA----RMDWQTLHTQSYP 180
                :|:||.:||:    :|.:..:...:||
 Worm   120 ----SPTSSVSSSSYSPTQMCYPPVSYSNYP 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 18/47 (38%)
hlh-14NP_495131.3 bHLH_SF 9..60 CDD:381792 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.