DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and Nhlh1

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_035046.1 Gene:Nhlh1 / 18071 MGIID:98481 Length:133 Species:Mus musculus


Alignment Length:51 Identity:24/51 - (47%)
Similarity:32/51 - (62%) Gaps:0/51 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 RNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYIKQL 83
            |.|...|||:|:...:.|:..|:..||.:|||.||||::.||||..||..|
Mouse    77 RTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYL 127

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 23/49 (47%)