DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and TWIST2

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001258822.1 Gene:TWIST2 / 117581 HGNCID:20670 Length:160 Species:Homo sapiens


Alignment Length:101 Identity:35/101 - (34%)
Similarity:49/101 - (48%) Gaps:22/101 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKKRSSSPTEFFDDDFDEDAS----------SQSSQP----PVQRNAANARERMRMRVLSSAYGR 53
            ||:|.|..:       .||.|          |.|:|.    ..||..||.|||.|.:.|:.|:..
Human    31 RKRRYSKKS-------SEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAA 88

  Fly    54 LKTKLPNIPPDTKLSKLDTLRLATLYIKQLITAVET 89
            |:..:|.:|.| ||||:.||:||..||..|...:::
Human    89 LRKIIPTLPSD-KLSKIQTLKLAARYIDFLYQVLQS 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 24/50 (48%)
TWIST2NP_001258822.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..63 10/38 (26%)
bHLH_TS_TWIST2 51..132 CDD:381543 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149606
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.