DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and Ferd3l

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_277057.1 Gene:Ferd3l / 114712 MGIID:2150010 Length:168 Species:Mus musculus


Alignment Length:49 Identity:24/49 - (48%)
Similarity:35/49 - (71%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QRNAANARERMRMRVLSSAYGRLKTKLPNIPPDTKLSKLDTLRLATLYI 80
            ||.|||.|||.||..|:.|:.:|:.|:|....:.:||:::|||||.:||
Mouse   104 QRQAANIRERKRMFNLNEAFDQLRRKVPTFAYEKRLSRIETLRLAIVYI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 24/49 (49%)
Ferd3lNP_277057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..88
bHLH domain 104..159 24/49 (49%)
HLH 104..156 CDD:278439 24/49 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839677
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.