DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and ascl2

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_002940290.3 Gene:ascl2 / 100494131 XenbaseID:XB-GENE-6458615 Length:236 Species:Xenopus tropicalis


Alignment Length:154 Identity:37/154 - (24%)
Similarity:58/154 - (37%) Gaps:54/154 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 NARERMRMRVLSSAYGRLKTKLPNIP-PDTKLSKLDTLRLATLYIK--QLITAVETGSHSQNHPH 98
            |.|||.|:::::..:.:|:..:|... |:.|:||::|||.|..||:  |.|....|....|..  
 Frog   117 NERERNRVKLVNLGFAKLRQHVPQAQGPNKKMSKVETLRSAVEYIRALQSILMERTAGEGQGR-- 179

  Fly    99 NHNQHHSLNHSHSSTTSSEGLDTSHMADSSGGGNYNFHNNGHGMSWPFEFHQSSRSLAFAPSS-- 161
                           ..|:||.....:.|...|                      |||.:|.|  
 Frog   180 ---------------AGSDGLSPCGSSCSVDSG----------------------SLALSPGSCS 207

  Fly   162 --STTSSARMD--------WQTLH 175
              ::..|:|.|        :.|||
 Frog   208 SCASEDSSRGDSSIAETDFFLTLH 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 17/48 (35%)
ascl2XP_002940290.3 bHLH_TS_ASCL2_Mash2 110..174 CDD:381586 20/56 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.