DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HLH54F and lyl1

DIOPT Version :9

Sequence 1:NP_477302.1 Gene:HLH54F / 37027 FlyBaseID:FBgn0022740 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_009300341.1 Gene:lyl1 / 100333113 ZFINID:ZDB-GENE-090807-1 Length:326 Species:Danio rerio


Alignment Length:137 Identity:48/137 - (35%)
Similarity:67/137 - (48%) Gaps:22/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RKKRSSSPTEFFDDDFDEDASSQSSQPP---VQRNAANARERMRMRVLSSAYGRLKTKLPNIPPD 64
            |.||..| |.|       :...:|..||   .:|...|:|||.|.:.::.|:..|:..:|..|||
Zfish   177 RMKRRPS-THF-------EVEIRSDGPPQKLARRVFTNSRERWRQQNVNGAFSELRKLIPTHPPD 233

  Fly    65 TKLSKLDTLRLATLYI---KQLIT----AVETGSHSQNHPHNHNQHHSLNHSHSSTTSSEGLDTS 122
            .||||.:.||||..||   :||:.    ..|||..:  |.|..:.|..|..:.||.:|..| ||.
Zfish   234 RKLSKNEILRLAMKYIDFLEQLLNDQSQPEETGQRA--HAHTPSTHSLLLLTASSGSSCYG-DTD 295

  Fly   123 HMADSSG 129
             ..:|:|
Zfish   296 -SEESTG 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HLH54FNP_477302.1 HLH 32..83 CDD:278439 22/53 (42%)
lyl1XP_009300341.1 HLH 206..256 CDD:197674 22/49 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.